PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn139181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 403aa    MW: 45093.9 Da    PI: 7.7482
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn139181genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1049.2e-33257312156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rFv+a++qLGGs++AtPk+i++lm+v+gLt+++vkSHLQkYRl+
  Achn139181 257 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRDLMQVDGLTNDEVKSHLQKYRLH 312
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.856254314IPR017930Myb domain
SuperFamilySSF466891.66E-17255315IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-29255315IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-27257312IPR006447Myb domain, plants
PfamPF002491.2E-7259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MGSIPRELSL DVRPTFIPKT ISEFLGELTE IGSATEKLTR LDDFVKRLED EMRKIDAFKR  60
ELPLCMILLN DAIVTLKEES TERRARNVEP VLEEFIPLKK SCDEDEKDEV KKEKDGDKMN  120
WMSSVQLWNY NDCKNIGSKY DQKQNSIPQF IQGVGEECPL VSDDPFECNK NKTGSKTFVP  180
FKVCSIFPAT RTRKEDKMEI PKLSLLTPRT KNLREEVGSN GLSSKISGSR ADSSTTTTSN  240
LNLRARPQTP QQQNTRKQRR CWSPELHRRF VNALQQLGGS QVATPKQIRD LMQVDGLTND  300
EVKSHLQKYR LHTRRLPNAT GTPANQPVVL LGVLWMPQDQ NGESSKQSSS KSGSPQGPLQ  360
LAGTGGGTST TGGESMEDED DEEKSESYSW KSHIPMSGKV GA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284970.21e-167PREDICTED: uncharacterized protein LOC100267475 isoform X2
TrEMBLA5BS051e-169A5BS05_VITVI; Putative uncharacterized protein
STRINGVIT_03s0063g01060.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-59G2-like family protein